PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0121500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 280aa    MW: 29782.5 Da    PI: 7.2146
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0121500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57e-391370461
          zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    + l+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  Spipo0G0121500 13 QLLRCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRI 70
                    6789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-271369IPR003851Zinc finger, Dof-type
PfamPF027011.1E-331469IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.461569IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101753IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEKIPGGPAS DGQLLRCPRC DSSNTKFCYY NNYSLSQPRH FCKACKRYWT RGGTLRNVPV  60
GGGCRKNKRI RKSTAAPTAA LPSQAELSAP VPPLSFLPSS SSISTASADI GFLFYNLATS  120
APDVGLPGLP APYDLSLGFP SNTEDEYLPR LNPVAAPLQS YSLFGNQPMS STTSACLLSS  180
SFKDPQHNEE AMENRQLSAF SDIHQLAADG SPPIFKDVKP LCGTNGVMTG SANGRSDWEL  240
PSCENAVDFP LYWNAAASAL GGGLWPDSAN YGFSIAPLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9661211e-45EU966121.1 Zea mays clone 291888 hypothetical protein mRNA, complete cds.
GenBankKJ7276861e-45KJ727686.1 Zea mays clone pUT5625 C2C2-DOF transcription factor (DOF34) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008779534.12e-60PREDICTED: dof zinc finger protein DOF1.4-like
RefseqXP_008779535.12e-60PREDICTED: dof zinc finger protein DOF1.4-like
RefseqXP_008779536.12e-60PREDICTED: dof zinc finger protein DOF1.4-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-34Dof family protein